DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CLEC4A

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:126 Identity:31/126 - (24%)
Similarity:51/126 - (40%) Gaps:15/126 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            ||..|||.:|.::.:.|..:.:.|:...|.:|.|.:...|....:   |:...:|  ..|...|.
Human   118 YFISTESASWQDSEKDCARMEAHLLVINTQEEQDFIFQNLQEESA---YFVGLSD--PEGQRHWQ 177

  Fly   116 TNAQ---RISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ...|   ..||..|...:|.:  ..|.|:.|.: .|..:::..||..|.....|    :||
Human   178 WVDQTPYNESSTFWHPREPSD--PNERCVVLNF-RKSPKRWGWNDVNCLGPQRS----VCE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 29/124 (23%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 31/126 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.