DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4a4

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005860.1 Gene:Clec4a4 / 474145 MGIID:3624119 Length:236 Species:Mus musculus


Alignment Length:207 Identity:46/207 - (22%)
Similarity:83/207 - (40%) Gaps:48/207 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKLTVLLITLLVIAKTGWTR-----EKFS-----------IQVNEGNTF--GALVKA-------- 40
            |.||.|::.||::|.|....     :|:|           |...|.|..  |:|::.        
Mouse    45 LLLTSLMLLLLLLAITFLVAFIIYFQKYSQLLEEKEAAKNIMYKELNCIKNGSLMEDKVWSCCPK 109

  Fly    41 --EPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSG 103
              :||  ::..|:.......:|.|:.|||..:.:.||...:..|.|.:|:.|..:..   |:.. 
Mouse   110 DWKPF--VSHCYFILNDSKASWNESEEKCSHMGAHLVVIHSQAEQDFITSNLNTSAG---YFIG- 168

  Fly   104 NDLAKTGSHRWFTNAQ---RISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPN 165
              |...|..:|....|   ..|:..|.:.:|:.  ..|.|:.:.:   .:..:..||.||..:.|
Mouse   169 --LLDAGQRQWRWIDQTPYNKSATFWHKGEPNQ--DWERCVIINH---KTTGWGWNDIPCKDEHN 226

  Fly   166 SLFKYICEAPEM 177
            |    :|:..::
Mouse   227 S----VCQVKKI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 27/124 (22%)
Clec4a4NP_001005860.1 CLECT_DC-SIGN_like 107..230 CDD:153060 30/139 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.