Sequence 1: | NP_001188845.1 | Gene: | Lectin-galC1 / 35216 | FlyBaseID: | FBgn0016675 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005860.1 | Gene: | Clec4a4 / 474145 | MGIID: | 3624119 | Length: | 236 | Species: | Mus musculus |
Alignment Length: | 207 | Identity: | 46/207 - (22%) |
---|---|---|---|
Similarity: | 83/207 - (40%) | Gaps: | 48/207 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 LKLTVLLITLLVIAKTGWTR-----EKFS-----------IQVNEGNTF--GALVKA-------- 40
Fly 41 --EPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSG 103
Fly 104 NDLAKTGSHRWFTNAQ---RISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPN 165
Fly 166 SLFKYICEAPEM 177 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lectin-galC1 | NP_001188845.1 | CLECT | 51..173 | CDD:153057 | 27/124 (22%) |
Clec4a4 | NP_001005860.1 | CLECT_DC-SIGN_like | 107..230 | CDD:153060 | 30/139 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR22802 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X73 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.010 |