DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec-224

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001041207.2 Gene:clec-224 / 4363112 WormBaseID:WBGene00044790 Length:195 Species:Caenorhabditis elegans


Alignment Length:139 Identity:31/139 - (22%)
Similarity:55/139 - (39%) Gaps:32/139 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLVIAKTGWTREKFSIQVNE------GNTFGALVK-AEPF-TKINDGYYFFG-------TESLNW 60
            :||::......:..||:..:      |.|....|. .||. ....:|:..:|       .:.|..
 Worm    14 ILVVSSASAKLDLGSIKKQQTYPSGTGTTISTSVSTVEPCNVGCQNGWVPYGGNCYRKMVDVLTQ 78

  Fly    61 YEAYEKCRELNSELVTFETDQEFDAVTAFLTA----NGSRLTYWTSGND----LAKTGSHRW--- 114
            ..|.::|.||.:.|.:|||..|..:|...:.:    :...|::.:|..:    |:||.:..|   
 Worm    79 ESAEQECVELGAHLASFETTDEATSVKNLVLSSPLFSDDLLSFTSSSQETWIGLSKTNNGAWKWV 143

  Fly   115 ------FTN 117
                  |||
 Worm   144 NSSDVDFTN 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 21/91 (23%)
clec-224NP_001041207.2 CLECT 57..188 CDD:214480 22/96 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.