DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and ASGR1

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001662.1 Gene:ASGR1 / 432 HGNCID:742 Length:291 Species:Homo sapiens


Alignment Length:137 Identity:32/137 - (23%)
Similarity:56/137 - (40%) Gaps:23/137 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            |:|......|.:|...||..::.||...:.:|    ..|:..:...:..|...:|  :.|..:|.
Human   166 YWFSRSGKAWADADNYCRLEDAHLVVVTSWEE----QKFVQHHIGPVNTWMGLHD--QNGPWKWV 224

  Fly   116 TNAQRISSLR-WARNQPDN-----AGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEA 174
            ......:..: |...|||:     .|..|.|.|    :.|..::  ||..| |.|   ::::||.
Human   225 DGTDYETGFKNWRPEQPDDWYGHGLGGGEDCAH----FTDDGRW--NDDVC-QRP---YRWVCET 279

  Fly   175 PEMETIS 181
             |::..|
Human   280 -ELDKAS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 28/127 (22%)
ASGR1NP_001662.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Lectin_N 4..144 CDD:461106
Endocytosis signal. /evidence=ECO:0000255 5..8
CLECT_DC-SIGN_like 154..279 CDD:153060 29/128 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.