DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4b2

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001004159.1 Gene:Clec4b2 / 381809 MGIID:3588267 Length:208 Species:Mus musculus


Alignment Length:204 Identity:51/204 - (25%)
Similarity:82/204 - (40%) Gaps:59/204 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LTVLLITLLVIAKTGWTREKFSIQVN--------------------EGNTFGALVKA------EP 42
            :::||::...||....|   :.:.:|                    ||.|....|.:      :|
Mouse    24 ISILLLSTCFIASCVVT---YQLMMNKPNRRLSELHTYHSNLICFSEGTTVSEKVWSCCPKDWKP 85

  Fly    43 FTKINDGY-YFFGTES-LNWYEAYEKCRELNSELVTFETDQEFDAVTAFL-TANGSRLTYWTSGN 104
            |    ..| ||..|:| .:..::.|||....:.||...:.:|.|.:|..| ||.|    |:..  
Mouse    86 F----GSYCYFTSTDSRASQNKSEEKCSLRGAHLVVIHSQEEQDFITRMLDTAAG----YFIG-- 140

  Fly   105 DLAKTGSHRWFTNAQRISSLR---WARNQPDNAGQKEHCIHLGYIYKDSRK--FELNDRPCSQDP 164
             |:..|:.:|....|...:.|   |.:.:|:|  ..|.|:.|.|     ||  :..||..||.:.
Mouse   141 -LSDVGNSQWRWIDQTPYNDRATFWHKGEPNN--DYEKCVILNY-----RKTMWGWNDIDCSDEE 197

  Fly   165 NSLFKYICE 173
            ||    :|:
Mouse   198 NS----VCQ 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 37/128 (29%)
Clec4b2NP_001004159.1 CLECT_DC-SIGN_like 79..203 CDD:153060 41/146 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.