DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and nw

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001027435.2 Gene:nw / 3772015 FlyBaseID:FBgn0283508 Length:491 Species:Drosophila melanogaster


Alignment Length:174 Identity:44/174 - (25%)
Similarity:74/174 - (42%) Gaps:48/174 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 ALVKAEPFTKIN-DGYYFF------GTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFL-TA 92
            |....:..|.|: ||..:|      .:..||::.||:.||.|..:|.:|||.::.:::|.:| .|
  Fly    14 ACAAGQRITTIHLDGVQYFISRMNPYSPELNYFLAYQYCRSLGLQLASFETKEKAESMTTYLKNA 78

  Fly    93 NGSRLTYWTSGNDLAKTGSHRW-------------FTNA---------------QRISSLRWARN 129
            ......:|||||.|. ||...|             |.|:               ...|..|.||:
  Fly    79 GYGNYDFWTSGNRLG-TGMFLWMSTGLPFNATFDFFENSADAIQAGLLDPVDHNSNTSPQRTARD 142

  Fly   130 QPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
              .::|.::.|:.|       ::..|...|  :|.:::..:|||
  Fly   143 --SSSGAEKGCVIL-------KQPTLKWMP--EDCSAVKDFICE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 37/156 (24%)
nwNP_001027435.2 CLECT 31..176 CDD:153057 39/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.