DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CG14499

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001261072.3 Gene:CG14499 / 37086 FlyBaseID:FBgn0034317 Length:188 Species:Drosophila melanogaster


Alignment Length:154 Identity:34/154 - (22%)
Similarity:57/154 - (37%) Gaps:43/154 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTA---NGSRLTYWTSGN 104
            ||::......|.....|:.:.:  |:.||:.|::|....||.|:..:||.   ....|  |||||
  Fly    35 FTQVAGKCLLFDNSWKNFLDRH--CQSLNAGLLSFSNKMEFTAINEWLTTVVPQSPEL--WTSGN 95

  Fly   105 DLAKTGSHRWFTNAQRISSLRWARNQP------------------DNAGQKEHCIHLGYIYKDSR 151
            .|..:..:.|.:..::...|.|...||                  :.....||            
  Fly    96 KLGGSEDYYWQSTGKKAFYLPWQAGQPTPITGDCLTLLANVTMTAEGTTMSEH------------ 148

  Fly   152 KFELNDRPCSQDPNSLFKYICEAP 175
              .|:.|.|::    ...::|:||
  Fly   149 --RLSVRGCTK----WAPHVCQAP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 29/142 (20%)
CG14499NP_001261072.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.