DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4d

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001003707.2 Gene:Clec4d / 362432 RGDID:1303339 Length:218 Species:Rattus norvegicus


Alignment Length:126 Identity:33/126 - (26%)
Similarity:54/126 - (42%) Gaps:12/126 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            ||...::..|:|:...|..::|.|||..|:.|.|.||..|   ..:.:|:...:.....|..:|.
  Rat    94 YFPLNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLL---DEQFSYFLGLSYEKVEGQWQWV 155

  Fly   116 TNAQ-RISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEAP 175
            .... ..:.:.|...:|.:. .:|.|:.|.|   |..|:..||.||..:...    ||:.|
  Rat   156 DKTPFNPNVVFWKVGEPKDY-MEEDCVVLVY---DQDKWVWNDFPCHFEMGR----ICKLP 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 31/122 (25%)
Clec4dNP_001003707.2 CLECT_DC-SIGN_like 82..206 CDD:153060 31/122 (25%)

Return to query results.
Submit another query.