DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4a1

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005890.1 Gene:Clec4a1 / 362430 RGDID:1359109 Length:243 Species:Rattus norvegicus


Alignment Length:205 Identity:42/205 - (20%)
Similarity:79/205 - (38%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKLTVLLITLLVIAKTGWTR--EKFSIQVNEGNTFGALVKA----------------------- 40
            :|.|.:..:.|.:::..|.|.  ..:|..:.|.||...|..|                       
  Rat    52 LLALLIFFLVLAILSSVGLTTLFHMYSDLLEEKNTLQQLNHAKLHCIKNHSSVEDKVWSCCPKNW 116

  Fly    41 EPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGND 105
            :||   ....||...:|.:|.::.|||....:.|:...:.:|.|.:|..|   ..|..|:...:|
  Rat   117 KPF---GSHCYFTSRDSASWSDSEEKCSHRGAHLLVIHSQEEQDFITDTL---NPRAHYYVGLSD 175

  Fly   106 LAKTGSHRWFTNA---QRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSL 167
            ....|..:|....   |..:|  |..::|  :|.|..|:.|.| :.:.:.:..:..||    :..
  Rat   176 TEGHGKWQWVDQTPFNQNATS--WHADEP--SGNKGFCVVLSY-HPNLKGWGWSVAPC----DGY 231

  Fly   168 FKYICEAPEM 177
            .:.:|:..::
  Rat   232 HRLVCKMRQL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 28/124 (23%)
Clec4a1NP_001005890.1 CLECT_DC-SIGN_like 112..238 CDD:153060 31/140 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.