DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CLEC4D

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_525126.2 Gene:CLEC4D / 338339 HGNCID:14554 Length:215 Species:Homo sapiens


Alignment Length:167 Identity:47/167 - (28%)
Similarity:77/167 - (46%) Gaps:24/167 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AKTGWTREKFSIQVNEGNTFGALVKAEP--FTKINDGYYFFGTESLNWYEAYEKCRELNSELVTF 77
            ||....:||..::..||:|:...    |  :.......||..|::..|.|:...|..:.:.|:|.
Human    62 AKLKCIKEKSELKSAEGSTWNCC----PIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTI 122

  Fly    78 ETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFT----NAQRISSLRWARNQPDNAGQKE 138
            .|:.|.:.:..||   ..||:|:....|....|..||..    |.:|:.   |.:|:|||: |.|
Human   123 STEAEQNFIIQFL---DRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVF---WHKNEPDNS-QGE 180

  Fly   139 HCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEAP 175
            :|:.|.|   :..|:..||.||:.:.:.    ||:.|
Human   181 NCVVLVY---NQDKWAWNDVPCNFEASR----ICKIP 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 37/125 (30%)
CLEC4DNP_525126.2 CLECT_DC-SIGN_like 84..208 CDD:153060 38/141 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5418
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R17423
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.