DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CG2839

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster


Alignment Length:168 Identity:35/168 - (20%)
Similarity:69/168 - (41%) Gaps:33/168 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 EKFSIQVNEGNTFGAL------------VKAEP-FTKINDGYYFFGTE-SLNWYEAYEKCRELNS 72
            :|.|::.:......||            |...| |.|:...:::.... ..||::|..||||:..
  Fly   115 KKLSLEKSLRKALNALQCSLDTRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGG 179

  Fly    73 ELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQK 137
            .|.:.:.::|...::..|...    :||...:||...|.:....:..:...|:|.:.||:.  :.
  Fly   180 HLASPQNEEELHLISQKLDTE----SYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNR--EN 238

  Fly   138 EHCIHL-GYIYKDSRKFELNDRPCSQDPNSLFKYICEA 174
            ..|:.: |.:|   :.|:.:.|         ..:||:|
  Fly   239 AQCVRVKGGLY---QTFQCDHR---------VLFICQA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 25/123 (20%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 28/133 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448821
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.