DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and lectin-21Cb

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_608539.2 Gene:lectin-21Cb / 33242 FlyBaseID:FBgn0040106 Length:249 Species:Drosophila melanogaster


Alignment Length:139 Identity:31/139 - (22%)
Similarity:57/139 - (41%) Gaps:20/139 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KAEP-FTKINDGYYFFGTE-SLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWT 101
            |..| |.|:...|::.... ..||::|.:|||.:...|.|.:.:.|...:...|.|.    .:|.
  Fly   127 KPHPEFQKLGSRYFYIERHVRQNWFDAADKCRRMGGHLATPQDEDELYLIRKQLEAR----WFWL 187

  Fly   102 SGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYK-DSRKFELNDRPCSQDPN 165
            ..::|.....:......:.:|.|:|...:|    :|....:..|:|. |...::.:||..     
  Fly   188 DISNLVDKDQYISLATGKEVSYLKWRHGEP----KKSSTANCAYLYAGDYYTYQCSDRNF----- 243

  Fly   166 SLFKYICEA 174
                :||:|
  Fly   244 ----FICQA 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 24/123 (20%)
lectin-21CbNP_608539.2 CLECT 137..247 CDD:153057 25/126 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448824
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.