DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CG12111

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster


Alignment Length:155 Identity:45/155 - (29%)
Similarity:76/155 - (49%) Gaps:16/155 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 VKAEPFTKINDGYYFF-GTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLT--Y 99
            :...||.:|.|.||:. ....:||::|...||.:|:.|.:.|...|.:|:..::.|.|.:..  :
  Fly    43 IDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYF 107

  Fly   100 WTSGNDLAKTGSHRWFTNAQRISSLRW--ARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQ 162
            |.|||||...|:..|.:|.:.::...|  .:..|||.|..|:|:|:     .:.:..:||..|..
  Fly   108 WISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHM-----FATREMINDANCKI 167

  Fly   163 DPNSLFKYICEAPEMET--ISIVVW 185
            .    ..|:|||.|.:|  .:.:.|
  Fly   168 Q----MLYVCEATEPKTFKFTYIKW 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 34/126 (27%)
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/127 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448792
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 85 1.000 Inparanoid score I7429
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26853
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
87.910

Return to query results.
Submit another query.