DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CD209

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_066978.1 Gene:CD209 / 30835 HGNCID:1641 Length:404 Species:Homo sapiens


Alignment Length:136 Identity:33/136 - (24%)
Similarity:64/136 - (47%) Gaps:18/136 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLT--YWTSGNDLAKTGSHR 113
            ||......||:::...|:|:.::||..::.:|.:    ||....||..  .|...:||.:.|:.:
Human   268 YFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQN----FLQLQSSRSNRFTWMGLSDLNQEGTWQ 328

  Fly   114 WFTNAQRISSLR--WARNQPDNAGQKEHCIHLGYIYKDSR----KF---ELNDRPCSQDPNSLFK 169
            |...:..:.|.:  |.|.:|:|.|:::.....|..:.|.:    ||   :.:...||:|..   :
Human   329 WVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEE---Q 390

  Fly   170 YICEAP 175
            ::..||
Human   391 FLSPAP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 31/132 (23%)
CD209NP_066978.1 Endocytosis signal 14..15
Endocytosis signal. /evidence=ECO:0000255 16..18
Endocytosis signal. /evidence=ECO:0000255 31..34
transmembrane domain 36..59
GumC <53..>225 CDD:442439
neck domain 60..249
CLECT_DC-SIGN_like 256..379 CDD:153060 28/114 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.