DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Colec10

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:124 Identity:25/124 - (20%)
Similarity:48/124 - (38%) Gaps:11/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRW 114
            :|:...|..|:.|:...|| :...::....|:..:.:.|...|.......:...|||.|.|.:.:
  Rat   159 FYYIVQEEKNYRESLTHCR-IRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEKEGQYVF 222

  Fly   115 FTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ..|....:...|...:|.:....|.|:.:    ..|.::  ||..|    :....::||
  Rat   223 TDNTPLQNYSNWKEGEPSDPYGHEDCVEM----LSSGRW--NDTEC----HLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 23/121 (19%)
Colec10NP_001124013.1 Collagen 45..94 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 25/124 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.