DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Colec10

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001124013.1 Gene:Colec10 / 299928 RGDID:1307149 Length:277 Species:Rattus norvegicus


Alignment Length:124 Identity:25/124 - (20%)
Similarity:48/124 - (38%) Gaps:11/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRW 114
            :|:...|..|:.|:...|| :...::....|:..:.:.|...|.......:...|||.|.|.:.:
  Rat   159 FYYIVQEEKNYRESLTHCR-IRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEKEGQYVF 222

  Fly   115 FTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ..|....:...|...:|.:....|.|:.:    ..|.::  ||..|    :....::||
  Rat   223 TDNTPLQNYSNWKEGEPSDPYGHEDCVEM----LSSGRW--NDTEC----HLTMYFVCE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 23/121 (19%)
Colec10NP_001124013.1 gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 25/124 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.