DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4a2

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001005880.1 Gene:Clec4a2 / 297584 RGDID:1359163 Length:235 Species:Rattus norvegicus


Alignment Length:131 Identity:30/131 - (22%)
Similarity:59/131 - (45%) Gaps:16/131 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTES-LNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRW 114
            ||..|:| ..|.|:.|||..:.:.|:...:..|.|.:...|...   ..|:...:|.:: ...:|
  Rat   119 YFTSTDSKATWDESKEKCSRMGAHLLVIHSQDEQDFINTILNIG---TDYFIGLSDHSE-NQWQW 179

  Fly   115 FTNAQRISSLR-WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEAPEME 178
            ........|:. |.:.:|:|  ::|.|:.:.  ::|  |:..||.||    :...|.:|:..::.
  Rat   180 IDQTPYNESVTFWHKGEPNN--KEEKCVVIN--HRD--KWGWNDIPC----HDRHKSVCQVKKIH 234

  Fly   179 T 179
            :
  Rat   235 S 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 29/123 (24%)
Clec4a2NP_001005880.1 CLECT_DC-SIGN_like 107..229 CDD:153060 29/123 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.