DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4m

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_038945074.1 Gene:Clec4m / 288378 RGDID:1561466 Length:336 Species:Rattus norvegicus


Alignment Length:124 Identity:31/124 - (25%)
Similarity:48/124 - (38%) Gaps:19/124 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            ||......||.:|...|:|..::||...:|:|...:.....|.|..   |...:||....:..|.
  Rat   218 YFLSKSQRNWNDAVRACKEEKAQLVIINSDEEQTFLQLTSKAKGPT---WMGLSDLKNEATWLWV 279

  Fly   116 TNAQRISSLR--WARNQPDNAGQKEHCIHL---GYIYKDSRKFELNDRPCSQDPNSLFK 169
            ..:...|..:  |.|.:|:|.|: |.|:..   |:          ||..|......:||
  Rat   280 DGSTLSSRFQKYWNRGEPNNIGE-EDCVEFAGDGW----------NDSKCELKKFWIFK 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 31/124 (25%)
Clec4mXP_038945074.1 CLECT_DC-SIGN_like 206..328 CDD:153060 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.