DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CLEC4E

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:127 Identity:31/127 - (24%)
Similarity:52/127 - (40%) Gaps:16/127 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSG-NDLAKTGSHRW 114
            |||.|::::|..:.:.|..:.:.||...:.:|.:    ||:....::..:..| :|....|..:|
Human    92 YFFSTDTISWALSLKNCSAMGAHLVVINSQEEQE----FLSYKKPKMREFFIGLSDQVVEGQWQW 152

  Fly   115 FTNAQRISSLR-WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKY--ICE 173
            ........||. |...:|:|....|.|..:    :||.    |.|....|......|  |||
Human   153 VDGTPLTKSLSFWDVGEPNNIATLEDCATM----RDSS----NPRQNWNDVTCFLNYFRICE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 29/125 (23%)
CLEC4ENP_055173.1 CLECT_DC-SIGN_like 80..207 CDD:153060 31/127 (24%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 169..171 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5418
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.150

Return to query results.
Submit another query.