DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Sftpd

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_037010.1 Gene:Sftpd / 25350 RGDID:3667 Length:374 Species:Rattus norvegicus


Alignment Length:163 Identity:37/163 - (22%)
Similarity:63/163 - (38%) Gaps:35/163 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 KTGWTREKFSIQVNEGNTFG-----ALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELV 75
            :..::|.|.:....:|.:.|     |....|||.                 :|.|.||:...:|.
  Rat   241 EAAFSRYKKAALFPDGQSVGDKIFRAANSEEPFE-----------------DAKEMCRQAGGQLA 288

  Fly    76 TFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHC 140
            :..:..|..||...:||:..  ..:.|..|:...|...:.|....:.| .||..:|:|.|..|:|
  Rat   289 SPRSATENAAVQQLVTAHSK--AAFLSMTDVGTEGKFTYPTGEALVYS-NWAPGEPNNNGGAENC 350

  Fly   141 IHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            :.   |:.:.   :.||:.|.:..    ..|||
  Rat   351 VE---IFTNG---QWNDKACGEQR----LVICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 27/121 (22%)
SftpdNP_037010.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..221
Collagen 41..89 CDD:189968
Collagen 66..124 CDD:189968
Collagen 114..172 CDD:189968
Surfac_D-trimer 223..268 CDD:286141 5/26 (19%)
CLECT 261..374 CDD:295302 33/143 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.