DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Reg1a

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_036773.1 Gene:Reg1a / 24714 RGDID:3552 Length:165 Species:Rattus norvegicus


Alignment Length:130 Identity:27/130 - (20%)
Similarity:59/130 - (45%) Gaps:21/130 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNS-ELVTFETDQEFDAVTAFLTANG-SRLTYWTSGNDLAKTGSHR 113
            |:|..:.|:|.||...|:.:|| .||:..:..|.:.:.:.:..:| :....|...:|  ...:.|
  Rat    47 YYFMEDHLSWAEADLFCQNMNSGYLVSVLSQAEGNFLASLIKESGTTAANVWIGLHD--PKNNRR 109

  Fly   114 WFTNAQRISSLR-WARNQPDNAGQKEHCIHL----GYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            |..::..:...: |....|:|: .:.:|:.:    ||     :|:  .|..|    ::...::|:
  Rat   110 WHWSSGSLFLYKSWDTGYPNNS-NRGYCVSVTSNSGY-----KKW--RDNSC----DAQLSFVCK 162

  Fly   174  173
              Rat   163  162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 26/128 (20%)
Reg1aNP_036773.1 CLECT 35..163 CDD:295302 27/130 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.