DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Cd207

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:180 Identity:48/180 - (26%)
Similarity:77/180 - (42%) Gaps:55/180 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLVIAKTGWTREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKC--RELNSE 73
            :|.:...||  :.||     ||                 :|:|......||.|.:.|  |:.:..
Mouse   194 ILEMVARGW--KYFS-----GN-----------------FYYFSRTPKTWYSAEQFCISRKAHLT 234

  Fly    74 LVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSH-RWF----TNAQRISSLR-WARNQPD 132
            .|:.|::|:|    .:..|:|  :.:|..   |.|.||. .|:    |:..:..|.| |...:|:
Mouse   235 SVSSESEQKF----LYKAADG--IPHWIG---LTKAGSEGDWYWVDQTSFNKEQSRRFWIPGEPN 290

  Fly   133 NAGQKEHCIHLGYIYKDSRKFEL---NDRPCSQDPNSLFKYICEAPEMET 179
            |||..|||.::       |...|   ||.||    ::.|.:||:.|.::|
Mouse   291 NAGNNEHCANI-------RVSALKCWNDGPC----DNTFLFICKRPYVQT 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 38/132 (29%)
Cd207NP_659192.2 CLECT_DC-SIGN_like 201..324 CDD:153060 45/166 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.