DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Mbl1

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_036731.2 Gene:Mbl1 / 24548 RGDID:3055 Length:238 Species:Rattus norvegicus


Alignment Length:135 Identity:30/135 - (22%)
Similarity:51/135 - (37%) Gaps:30/135 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GYYFFGT--ESLNWYEAYEKCRELNSELVTFETDQEFDAV------TAFLTANGSRLTYWTSGND 105
            |..||.|  |.:.:.:....|.||...:......:|..|:      :|||.....    .|.|..
  Rat   125 GKKFFVTNHERMPFSKVKALCSELRGTVAIPRNAEENKAIQEVAKTSAFLGITDE----VTEGQF 185

  Fly   106 LAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKY 170
            :..||....::|        |.:::|::.|..|.|:.:    .|:..:  ||..|.....:    
  Rat   186 MYVTGGRLTYSN--------WKKDEPNDHGSGEDCVTI----VDNGLW--NDISCQASHTA---- 232

  Fly   171 ICEAP 175
            :||.|
  Rat   233 VCEFP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 26/129 (20%)
Mbl1NP_036731.2 Collagen <36..86 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..87
CLECT_collectin_like 126..236 CDD:153061 27/131 (21%)
Calcium-dependent carbohydrate binding. /evidence=ECO:0000269|PubMed:11850428, ECO:0000269|PubMed:1436090, ECO:0000269|PubMed:9033386 202..210 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.