DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec9a

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001192292.1 Gene:Clec9a / 232414 MGIID:2444608 Length:264 Species:Mus musculus


Alignment Length:136 Identity:36/136 - (26%)
Similarity:58/136 - (42%) Gaps:21/136 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PFTKINDG---YYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSG 103
            |...|.:|   ||.|....: |..:.:.|.:..:.|...::.:|.:.:::.....|.. .||...
Mouse   138 PHNWIQNGKSCYYVFERWEM-WNISKKSCLKEGASLFQIDSKEEMEFISSIGKLKGGN-KYWVGV 200

  Fly   104 NDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLF 168
            .....:||..|...:..:|.|..|..| .:|||  .|   ||: |||..  ::|: |..     :
Mouse   201 FQDGISGSWFWEDGSSPLSDLLPAERQ-RSAGQ--IC---GYL-KDSTL--ISDK-CDS-----W 250

  Fly   169 KY-ICE 173
            || |||
Mouse   251 KYFICE 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 30/122 (25%)
Clec9aNP_001192292.1 CLECT_NK_receptors_like 137..257 CDD:153063 36/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.