DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Mgl2

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006532975.1 Gene:Mgl2 / 216864 MGIID:2385729 Length:381 Species:Mus musculus


Alignment Length:185 Identity:40/185 - (21%)
Similarity:55/185 - (29%) Gaps:70/185 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLA 107
            :|:.....|:|.....:|.||.:.||..||.||...:.:|.:    ||....:.:..|....|  
Mouse   194 WTEHEGSCYWFSESEKSWPEADKYCRLENSHLVVVNSLEEQN----FLQNRLANVLSWMGLTD-- 252

  Fly   108 KTGSHRW-------------------------------------------------FTNAQRISS 123
            :.|..||                                                 ..:||....
Mouse   253 QNGPWRWVDGTDFDKGFKYVCRLQLAPLYLGLSYLFSIFSDPRDLGGPSGNMADGQIWSAQFFIF 317

  Fly   124 LRWARNQPDN-----AGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ..|...||||     .|..|.|.|..|   |.|   .||..|.:.    :.:|||
Mouse   318 RNWRPLQPDNWHGHMLGGGEDCAHFSY---DGR---WNDDVCQRH----YHWICE 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 37/175 (21%)
Mgl2XP_006532975.1 Lectin_N 5..180 CDD:461106
CLECT_DC-SIGN_like 190..363 CDD:153060 40/185 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.