DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec-262

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_507917.2 Gene:clec-262 / 191051 WormBaseID:WBGene00013831 Length:333 Species:Caenorhabditis elegans


Alignment Length:181 Identity:40/181 - (22%)
Similarity:61/181 - (33%) Gaps:51/181 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 DGYYFFGTESLNW--------------YEAYEKCRELNSELVTFETDQEFDAVTA-FLTANGSR- 96
            ||:..|...:.||              .:|...|..:.:.|...||..|.|.|.| .||..|:. 
 Worm   149 DGWSMFVRPTTNWCLQVFGSPSVSYTQADAIHNCTNIGTVLSGLETLDERDFVAAGALTLLGAGY 213

  Fly    97 ---LTYWTSGNDLAKTGSHRW-------FTNAQRI----------SSLRWARNQPD--NAGQKEH 139
               ...|.||....:..|..|       .||.::.          :...|..|.||  :.|..::
 Worm   214 PEFAAVWVSGMRKPECYSDGWENLAECAGTNMEQFTYTDTYMANYAGYTWDPNTPDRNSTGVWQN 278

  Fly   140 CIHL---------GYIYKDSRKFELNDRPCS---QDPNSLFKYIC-EAPEM 177
            ||.:         .:.|..:.....:|..|:   .|..||..:.| :.||:
 Worm   279 CIQMWIRIESVSPDFPYDTNPNGNSDDATCNVADSDDFSLRGFACGKLPEI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 36/172 (21%)
clec-262NP_507917.2 CW 20..113 CDD:214742
CLECT 161..325 CDD:153057 34/163 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.