DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec-127

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_494580.2 Gene:clec-127 / 189338 WormBaseID:WBGene00021138 Length:318 Species:Caenorhabditis elegans


Alignment Length:137 Identity:28/137 - (20%)
Similarity:41/137 - (29%) Gaps:38/137 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KAEPFTK-----INDGYYFFGTESLNW------------YEAYEKCRELNSELVTFETDQEFDAV 86
            |..|.||     ...|:..|...|..|            .:|.|.||.:.:.|...:..||...:
 Worm   135 KPRPMTKPRVKVCPYGWATFNRPSGKWCIKVFIGHHAAQADAEEACRSIGTTLTGLQNKQEALFI 199

  Fly    87 TAFLTA-----NGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARN-------------QPDN 133
            ...|.:     :||   .|......|:...........|.::..|..|             ||||
 Worm   200 QKSLLSLIPQQSGS---VWLGLQRTARCMGQPLTATCSRTTAFEWTDNSATGTDGFLFQTGQPDN 261

  Fly   134 AGQKEHC 140
            ....::|
 Worm   262 GRLNQNC 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 23/120 (19%)
clec-127NP_494580.2 CLECT 147..274 CDD:214480 24/125 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.