DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec-40

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_507252.3 Gene:clec-40 / 188627 WormBaseID:WBGene00011853 Length:386 Species:Caenorhabditis elegans


Alignment Length:124 Identity:24/124 - (19%)
Similarity:44/124 - (35%) Gaps:39/124 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CRELNSELVTFETDQEFDAVTAFLT------------ANGSRLT--YWTSGNDLAKTGSHRWFTN 117
            |..|.:.|:|.::.:|...:.:||:            .||..:|  .|.:|:::........|.|
 Worm   155 CNRLGATLLTIQSSEENQKIQSFLSIHQISQIWLGLICNGKSVTSCQWDNGSNVTYYDFAPGFPN 219

  Fly   118 AQRISSLRWARNQPDNA-GQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEAP 175
            ..  :.:..:.|...|: ||.|..:    .||.                  ..::||.|
 Worm   220 VD--TGICVSYNITHNSIGQWESLV----CYKQ------------------LPFVCELP 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 21/120 (18%)
clec-40NP_507252.3 CLECT 127..252 CDD:214480 21/120 (18%)
CLECT 265..378 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.