DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec-7

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_504865.1 Gene:clec-7 / 184314 WormBaseID:WBGene00017364 Length:417 Species:Caenorhabditis elegans


Alignment Length:186 Identity:41/186 - (22%)
Similarity:59/186 - (31%) Gaps:59/186 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFD 84
            |..|..:..||            ||.||:......|...|...|.:.||:..:.|||.:.:.:..
 Worm    18 TSSKVPVCTNE------------FTLINNKCLKLFTTPANHSAAEKTCRKYGATLVTVKNENDNH 70

  Fly    85 AVTAFLTANGSRLTYWTS----GNDLAK------TGS---------------------------- 111
            |::.|...:.|.|  |..    |||.:|      |||                            
 Worm    71 AISTFAGTSASLL--WIGLYCFGNDPSKCLWDDSTGSADVYDNFASGFPLVDIGKCVYYSVQGAL 133

  Fly   112 -HRWFTNAQRISSLRWARNQPDNAGQKEHCI--HLGYIYK--DSRKFELNDRPCSQ 162
             .:|.|....:||..:....|...  .:.||  :.||.|.  ....|.:....|.|
 Worm   134 TGKWLTENCDLSSKAFMCELPTTF--SDSCIYNYNGYCYDYYAEASFVVAQNTCEQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 33/155 (21%)
clec-7NP_504865.1 CLECT 25..152 CDD:214480 30/140 (21%)
CLECT 165..282 CDD:214480 6/23 (26%)
CUB 308..412 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.