DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec-185

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_502375.4 Gene:clec-185 / 182914 WormBaseID:WBGene00007729 Length:504 Species:Caenorhabditis elegans


Alignment Length:134 Identity:30/134 - (22%)
Similarity:54/134 - (40%) Gaps:19/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 ESLNWYEAYEKCRELN--SELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNA 118
            |...||...|.||.|:  ::|.:|.:..|    :.|:....|.:..||.   |::|.:...:|..
 Worm   103 EKSEWYGGTELCRALHPQAQLASFHSQGE----SEFVCKKYSSIHAWTG---LSQTETPGVWTYT 160

  Fly   119 QRISSLRWARNQPDNAGQKEHCIHL--GYIYK----DSRKFELNDRPCSQDPNSLFKYICEAPEM 177
            .......|...|......::.|:.:  |.:..    .::|.:.....|::...|:.||   .|: 
 Worm   161 DGTPDWHWFFAQSSTMTTEKSCVEMMDGVLVLLFSWSAKKGQTQPYSCTESIASICKY---CPQ- 221

  Fly   178 ETIS 181
            ||.|
 Worm   222 ETTS 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 26/124 (21%)
clec-185NP_502375.4 CLECT 84..217 CDD:214480 24/120 (20%)
CLECT 391..500 CDD:214480
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.