DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec-225

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001021349.2 Gene:clec-225 / 181942 WormBaseID:WBGene00007152 Length:155 Species:Caenorhabditis elegans


Alignment Length:94 Identity:17/94 - (18%)
Similarity:36/94 - (38%) Gaps:25/94 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LNWYEAYEKCRELNSELVTFETDQEFDAV-----------------------TAFLTANGSRLTY 99
            |:.::|...|:::|:.|:..:|..:..||                       |..:..:||.|:|
 Worm    44 LSQHKAETTCKDMNAHLIFIQTAIDNTAVLNYASNITSPMWIGATCKVSEEPTKCMWDDGSYLSY 108

  Fly   100 --WTSGNDLAKTGSHRWFTNAQRISSLRW 126
              :..|..:...|:..:..:..:....||
 Worm   109 SNFLPGYPVTNIGTCVYLDSPNQPLKGRW 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 17/94 (18%)
clec-225NP_001021349.2 CLECT 25..152 CDD:214480 17/94 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.