DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and clec-52

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_501371.1 Gene:clec-52 / 181855 WormBaseID:WBGene00015052 Length:308 Species:Caenorhabditis elegans


Alignment Length:97 Identity:24/97 - (24%)
Similarity:35/97 - (36%) Gaps:37/97 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SLNWYEAYEKCRELNSELV--------TFETD--QEFDAVTAFLTANGSR--LT-----YWTSGN 104
            ::::..|...|..||..||        ||.:.  |:|....|:|.|..|.  :|     |||.|.
 Worm    40 AVDFQTAESICATLNGHLVSVHNAIDNTFVSGQAQKFIDGGAWLGAQASAPDVTNPLNWYWTDGT 104

  Fly   105 DL--------------------AKTGSHRWFT 116
            |.                    .:||:.:|.|
 Worm   105 DFNYQNYKVGQPTQTGSTACMQLETGTSKWQT 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 24/97 (25%)
clec-52NP_501371.1 CLECT 32..147 CDD:153057 24/97 (25%)
CLECT 166..303 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.