Sequence 1: | NP_001188845.1 | Gene: | Lectin-galC1 / 35216 | FlyBaseID: | FBgn0016675 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_500445.1 | Gene: | clec-73 / 177153 | WormBaseID: | WBGene00021579 | Length: | 577 | Species: | Caenorhabditis elegans |
Alignment Length: | 205 | Identity: | 42/205 - (20%) |
---|---|---|---|
Similarity: | 64/205 - (31%) | Gaps: | 83/205 - (40%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 KFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVT 87
Fly 88 AFLTANGSRLTYWTSGNDLAKTGSH-------------------------------------RWF 115
Fly 116 TN-AQRISSLRWARN----QPDNAGQKEHCI-----HLGYIYKDSRKFELNDRPCSQDPNSLFKY 170
Fly 171 ICE--APEME 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lectin-galC1 | NP_001188845.1 | CLECT | 51..173 | CDD:153057 | 32/168 (19%) |
clec-73 | NP_500445.1 | CLECT | 108..>174 | CDD:382969 | |
CLECT | <445..563 | CDD:382969 | 21/122 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |