Sequence 1: | NP_001188845.1 | Gene: | Lectin-galC1 / 35216 | FlyBaseID: | FBgn0016675 | Length: | 186 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_494450.1 | Gene: | clec-123 / 173658 | WormBaseID: | WBGene00021288 | Length: | 578 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 34/199 - (17%) |
---|---|---|---|
Similarity: | 66/199 - (33%) | Gaps: | 69/199 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 VIAKTGWTREKFSIQVNEGNTFGALVKAEPFTKIND---GYYFFGTESLNWYEAYEKCRELNSEL 74
Fly 75 VTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHR-------------------------W 114
Fly 115 FTN--AQRISSLRWARNQPDNAGQK-------EHCIHLGYIYKDSRKFELNDRPCSQDP--NSLF 168
Fly 169 KYIC 172 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Lectin-galC1 | NP_001188845.1 | CLECT | 51..173 | CDD:153057 | 27/158 (17%) |
clec-123 | NP_494450.1 | CLECT | 109..>180 | CDD:295302 | |
CLECT | 419..568 | CDD:153057 | 26/157 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |