DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Cd209a

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_573501.1 Gene:Cd209a / 170786 MGIID:2157942 Length:238 Species:Mus musculus


Alignment Length:185 Identity:42/185 - (22%)
Similarity:79/185 - (42%) Gaps:36/185 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TVLLITLLV-IAKTGWTREKFSIQVNEGNTFGALVKAE------------PFTKINDGYYFFGTE 56
            :|||:.:|| :.|...::|    :.|:.|.:..|.:.:            .:|......|||...
Mouse    65 SVLLVVILVKVYKIPSSQE----ENNQMNVYQELTQLKAGVDRLCRSCPWDWTHFQGSCYFFSVA 125

  Fly    57 SLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTY-WTSGNDLAKTGSHRWFTNAQR 120
            ..:|.::...|..:.::||..::|:|.:    ||.....:..| |....|::|..:..|...:..
Mouse   126 QKSWNDSATACHNVGAQLVVIKSDEEQN----FLQQTSKKRGYTWMGLIDMSKESTWYWVDGSPL 186

  Fly   121 ISSLR--WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ..|..  |::.:|:|.|: |.|..    ::|.   ..||..|:   |..| :||:
Mouse   187 TLSFMKYWSKGEPNNLGE-EDCAE----FRDD---GWNDTKCT---NKKF-WICK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 30/124 (24%)
Cd209aNP_573501.1 CLECT_DC-SIGN_like 108..230 CDD:153060 32/138 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.