DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Cd209e

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_570975.1 Gene:Cd209e / 170780 MGIID:2157948 Length:208 Species:Mus musculus


Alignment Length:146 Identity:36/146 - (24%)
Similarity:66/146 - (45%) Gaps:21/146 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTY-WTSGNDL 106
            :|..|...|||.....:|:::...|:|:.::||..::.:|    .:||.....:.:| |...:||
Mouse    81 WTFFNGNCYFFSKSQRDWHDSMTACKEMGAQLVIIKSHEE----QSFLQQTSKKNSYTWMGLSDL 141

  Fly   107 AKTGSHRWFTNAQRISSLR--WARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFK 169
            .|.|...|...:....|..  |.:.||:|.|.:: |:.    ::|:   ..||..|.|..    .
Mouse   142 NKEGEWYWLDGSPLSDSFEKYWKKGQPNNVGGQD-CVE----FRDN---GWNDAKCEQRK----F 194

  Fly   170 YICEAPEMETISIVVW 185
            :||:  ::.|..:..|
Mouse   195 WICK--KIATTCLSKW 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 31/124 (25%)
Cd209eNP_570975.1 CLECT_DC-SIGN_like 77..199 CDD:153060 34/135 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.