DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Cd209c

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_017168078.1 Gene:Cd209c / 170776 MGIID:2157945 Length:240 Species:Mus musculus


Alignment Length:30 Identity:7/30 - (23%)
Similarity:15/30 - (50%) Gaps:7/30 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 EQVKEKMLPFLEESEDPVKGVDVSVYGPDG 175
            |:|.:|:..:::|..:       .:|.|.|
Mouse    87 EKVLKKVSKYIQEQNE-------KIYAPQG 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 5/26 (19%)
Cd209cXP_017168078.1 CLECT_DC-SIGN_like 110..232 CDD:153060 7/30 (23%)

Return to query results.
Submit another query.