DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Lectin-galC1 and CLEC4F

DIOPT Version :9

Sequence 1:	NP_001188845.1	Gene:	Lectin-galC1 / 35216	FlyBaseID:	FBgn0016675	Length:	186	Species:	Drosophila melanogaster
Sequence 2:	XP_011530937.1	Gene:	CLEC4F / 165530	HGNCID:	25357	Length:	699	Species:	Homo sapiens

Alignment Length:	140	Identity:	36/140 - (25%)
Similarity:	49/140 - (35%)	Gaps:	36/140 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly    45 KINDG-YYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAK 108
            |.|.| .|:|.:...:|:||.:.|....:.|.:..:.:|    .|||....|::.||....|...
Human   584 KFNGGSLYYFSSVKKSWHEAEQFCVSQGAHLASVASKEE----QAFLVEFTSKVYYWIGLTDRGT 644

  Fly   109 TGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            .||  |          ||....|.||.|                   |..|.|:....|.|||..
Human   645 EGS--W----------RWTDGTPFNAAQ-------------------NKAPGSKGSCPLRKYIIV 678

  Fly   174 APEMETISIV 183
            ...|...|.:
Human   679 NSGMGACSFI 688

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Lectin-galC1	NP_001188845.1	CLECT	51..173	CDD:153057	31/121 (26%)
CLEC4F	XP_011530937.1	Lebercilin	374..556	CDD:292252
CLEC4F	XP_011530937.1	CLECT_DC-SIGN_like	581..>657	CDD:153060	24/88 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR22802
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	2.010