DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Fcer2a

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:132 Identity:35/132 - (26%)
Similarity:59/132 - (44%) Gaps:16/132 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            |:||..|..|.:|...|.:|...||:..:.:|.|    ||..:.::...|....||...|...| 
Mouse   202 YYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQD----FLMQHINKKDSWIGLQDLNMEGEFVW- 261

  Fly   116 TNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICEAPEMETI 180
            ::...:....|...:|:|.||.|.|:    :.:.|.::  ||..|.   :.|..::||  ::.|.
Mouse   262 SDGSPVGYSNWNPGEPNNGGQGEDCV----MMRGSGQW--NDAFCR---SYLDAWVCE--QLATC 315

  Fly   181 SI 182
            .|
Mouse   316 EI 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 31/121 (26%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056
CLECT_DC-SIGN_like 190..310 CDD:153060 31/121 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.