DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CG43055

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001245867.1 Gene:CG43055 / 12798556 FlyBaseID:FBgn0262357 Length:180 Species:Drosophila melanogaster


Alignment Length:186 Identity:71/186 - (38%)
Similarity:102/186 - (54%) Gaps:12/186 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KLTVLLITLLVIAKTGWTREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTE-SLNWYEAYEK 66
            |||.....|.:|:..  ...:.|..|.||..........||.||.|.|||...: ..|||:|:|.
  Fly     4 KLTAFSAFLAIISLC--RAYQISTSVIEGVASYLNTPTAPFVKIGDSYYFIENKLDRNWYDAFEA 66

  Fly    67 CRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQP 131
            ||::|::||.||..:|...:..:|..|....||||:|.|||:..|..||:|.|.::|..|..|:|
  Fly    67 CRQMNADLVAFEDRKEQKLIYHYLVDNEMDTTYWTAGTDLAEQDSFVWFSNGQPVASDLWCNNEP 131

  Fly   132 DNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFK--YICEAPEMETISIVVW 185
            :||..:|||:....::.:: |..||||.|:      ||  |||.||:.:|:|.:||
  Fly   132 NNAKNEEHCVEYKPLHPEA-KMGLNDRVCT------FKTGYICRAPQPKTVSFIVW 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 49/124 (40%)
CG43055NP_001245867.1 CLECT 49..167 CDD:153057 49/124 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0001931
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
77.070

Return to query results.
Submit another query.