DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Asgr1

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001278060.1 Gene:Asgr1 / 11889 MGIID:88081 Length:284 Species:Mus musculus


Alignment Length:129 Identity:33/129 - (25%)
Similarity:50/129 - (38%) Gaps:22/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWF 115
            |:|.:....|.||.:.|:..|:.||...:..|.:    ||..:...|..|....|  :.|..:|.
Mouse   165 YWFSSSVRPWTEADKYCQLENAHLVVVTSRDEQN----FLQRHMGPLNTWIGLTD--QNGPWKWV 223

  Fly   116 TNAQRISSLR-WARNQPDN-----AGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ......:..: |...||||     .|..|.|.|   ...|.|   .||..|.:.    ::::||
Mouse   224 DGTDYETGFQNWRPEQPDNWYGHGLGGGEDCAH---FTTDGR---WNDDVCRRP----YRWVCE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 31/127 (24%)
Asgr1NP_001278060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859
CLECT_DC-SIGN_like 153..278 CDD:153060 33/129 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.