| Sequence 1: | NP_001188845.1 | Gene: | Lectin-galC1 / 35216 | FlyBaseID: | FBgn0016675 | Length: | 186 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021331663.1 | Gene: | vcana / 116993 | ZFINID: | ZDB-GENE-011023-1 | Length: | 8936 | Species: | Danio rerio |
| Alignment Length: | 227 | Identity: | 47/227 - (20%) |
|---|---|---|---|
| Similarity: | 76/227 - (33%) | Gaps: | 79/227 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 LVIAKTGWTREKFSIQVNEGNT------------------------FGALVKAEPFT------KI 46
Fly 47 NDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTY---WTSGNDLAK 108
Fly 109 TGSHRWFTNAQRISSLRWARNQPDN-AGQKEHCIHLGYIYKDSRKFELNDRP------------- 159
Fly 160 --CSQDP-----------------NSLFKYIC 172 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Lectin-galC1 | NP_001188845.1 | CLECT | 51..173 | CDD:153057 | 36/158 (23%) |
| vcana | XP_021331663.1 | Ig | 36..148 | CDD:325142 | |
| Link_domain_CSPGs_modules_1_3 | 147..241 | CDD:239594 | |||
| Link_domain_CSPGs_modules_2_4 | 249..343 | CDD:239597 | |||
| Herpes_BLLF1 | <5897..>6290 | CDD:330317 | |||
| EGF | 8622..8652 | CDD:306513 | 2/10 (20%) | ||
| EGF_CA | 8656..8692 | CDD:238011 | 5/35 (14%) | ||
| CLECT_CSPGs | 8698..8821 | CDD:153058 | 28/135 (21%) | ||
| CCP | 8825..8881 | CDD:153056 | 9/30 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.920 | |||||