DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and Clec4f

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_446205.1 Gene:Clec4f / 114598 RGDID:621062 Length:550 Species:Rattus norvegicus


Alignment Length:134 Identity:34/134 - (25%)
Similarity:59/134 - (44%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 NDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGS 111
            |..:|:|..:..:|:||...|....:.|.:..:.:|    .|||....:.:.:|....|....|:
  Rat   420 NGKFYYFSRDKKSWHEAENFCVSQGAHLASVTSQEE----QAFLVQITNAVDHWIGLTDQGTEGN 480

  Fly   112 HRWF--TNAQRISSLR-WARNQPDN----AGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFK 169
            .||.  |....:.|.| |.:.||||    .|::|.|:||..::        ||..|    .:.:.
  Rat   481 WRWVDGTPFDYVQSRRFWRKGQPDNWRHGNGEREDCVHLQRMW--------NDMAC----GTAYN 533

  Fly   170 YICE 173
            ::|:
  Rat   534 WVCK 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 32/128 (25%)
Clec4fNP_446205.1 SMC_prok_B <100..390 CDD:274008
CLECT_DC-SIGN_like 414..538 CDD:153060 34/134 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.