DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and LOC103910168

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021327446.1 Gene:LOC103910168 / 103910168 -ID:- Length:109 Species:Danio rerio


Alignment Length:115 Identity:31/115 - (26%)
Similarity:55/115 - (47%) Gaps:10/115 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 NWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISS 123
            ||.|:.:.||:...:|:..:::::...||:|:|.. .::..|....|....|:..|..|:. ::.
Zfish     5 NWSESRQYCRDRGEDLLIIKSEEKQRRVTSFITEK-VKMPVWLGLTDAEIEGNMTWVDNSP-LNE 67

  Fly   124 LRWARNQPDNAGQKEHCIHLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            ..|.|.:|.|....|.|:.:..|...:    .||.|||    .|.::|||
Zfish    68 GFWMRGEPTNNDGIEDCVFMNAISSPN----WNDVPCS----ILARFICE 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 29/113 (26%)
LOC103910168XP_021327446.1 CLECT 2..109 CDD:321932 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 58 1.000 Inparanoid score I5416
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.