DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and CLEC4M

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_055072.3 Gene:CLEC4M / 10332 HGNCID:13523 Length:399 Species:Homo sapiens


Alignment Length:133 Identity:34/133 - (25%)
Similarity:59/133 - (44%) Gaps:28/133 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFL---TANGSRLTYWTSGNDLAKTGSH 112
            ||......||:::...|:|:.::||..:|.:|.:    ||   |:..:|.: |...:||.:.|:.
Human   280 YFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQN----FLQLQTSRSNRFS-WMGLSDLNQEGTW 339

  Fly   113 RWFTNAQRISSLR--WARNQPDNAGQKEHCIHL---GYIYKDSRKFELNDRPCSQDPNSLFKYIC 172
            :|...:....|.:  |...:|:|:| .|.|...   |:          ||..|..|.    .:||
Human   340 QWVDGSPLSPSFQRYWNSGEPNNSG-NEDCAEFSGSGW----------NDNRCDVDN----YWIC 389

  Fly   173 EAP 175
            :.|
Human   390 KKP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 32/129 (25%)
CLEC4MNP_055072.3 Endocytosis signal. /evidence=ECO:0000250 14..15
transmembrane domain 44..71
7 X approximate tandem repeats 108..269
DUF342 <140..251 CDD:302792
CLECT_DC-SIGN_like 268..391 CDD:153060 33/130 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.