DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and LOC101886537

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021327322.1 Gene:LOC101886537 / 101886537 -ID:- Length:284 Species:Danio rerio


Alignment Length:153 Identity:40/153 - (26%)
Similarity:64/153 - (41%) Gaps:26/153 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LVKAEPFTKINDGY-------YFFGTESLNWYEAYEKCRELNSELVTFETD-QEFDAVT--AFLT 91
            |.:.:|..:...|:       |...:..|.|.:|...|..::|.|:....| :|:|...  |.||
Zfish   146 LTQYKPVLRCKAGWQHFLSNCYLIPSTKLTWPKARSYCNGIDSLLLILGNDSREWDYFVQYAILT 210

  Fly    92 ANGSRLTYWTSGNDLAKTGSHRWFTNAQRI-SSLRWARNQPDNAGQKEHCIHLGYIYKDSRKFEL 155
            :.    :||....||. |...||......: :|..|...:|::...||.|..|      :...:|
Zfish   211 SE----SYWIGLTDLI-TSQWRWIDGKPYVMNSSHWEPGEPNDVLNKEDCGEL------TASGKL 264

  Fly   156 NDRPCSQDPNSLFKYICEAPEME 178
            ||..||:.    |::||:.|..|
Zfish   265 NDAQCSKS----FQFICKTPATE 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 34/125 (27%)
LOC101886537XP_021327322.1 CLECT_DC-SIGN_like 155..279 CDD:153060 36/138 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.