powered by:
Protein Alignment Lectin-galC1 and LOC101885796
DIOPT Version :9
Sequence 1: | NP_001188845.1 |
Gene: | Lectin-galC1 / 35216 |
FlyBaseID: | FBgn0016675 |
Length: | 186 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021323879.1 |
Gene: | LOC101885796 / 101885796 |
-ID: | - |
Length: | 264 |
Species: | Danio rerio |
Alignment Length: | 45 |
Identity: | 14/45 - (31%) |
Similarity: | 22/45 - (48%) |
Gaps: | 0/45 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 VKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQE 82
|.|..:|......|:|.|..|||:.:.:.|....::|||..:..|
Zfish 207 VSANGWTACRGQLYYFSTSKLNWFSSRDACVSRGADLVTITSQSE 251
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Lectin-galC1 | NP_001188845.1 |
CLECT |
51..173 |
CDD:153057 |
11/32 (34%) |
LOC101885796 | XP_021323879.1 |
CLECT |
5..>40 |
CDD:321932 |
|
CLECT |
211..>252 |
CDD:321932 |
12/41 (29%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.