DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and si:ch73-111e15.1

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_005172686.1 Gene:si:ch73-111e15.1 / 101885260 ZFINID:ZDB-GENE-110411-28 Length:271 Species:Danio rerio


Alignment Length:144 Identity:36/144 - (25%)
Similarity:62/144 - (43%) Gaps:33/144 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLA 107
            :|.....:|:...||.:|.::...|:...::|:|....||.|.|.. ||.|..   :|....|..
Zfish   140 WTYFQSSFYYLSNESKSWTDSRGDCKGRKADLITINNRQEQDFVMT-LTRNKE---FWIGLTDSE 200

  Fly   108 KTGSHRWFTNAQRISSLRWAR----NQPDNAGQKEHCI--HL-------GYIYKDSRKFELNDRP 159
            |.|..:| .:...:::..||.    .:| |.|.:|:|:  ||       |:|          |..
Zfish   201 KEGQWKW-VDGSTLTTGFWASFRSITEP-NGGTRENCVLTHLKRHPELIGWI----------DHN 253

  Fly   160 CSQDPNSLFKYICE 173
            |    ::.:::|||
Zfish   254 C----DASYQWICE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 33/134 (25%)
si:ch73-111e15.1XP_005172686.1 CLECT_DC-SIGN_like 139..264 CDD:153060 36/144 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.