DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and si:ch73-122g19.1

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_005155331.2 Gene:si:ch73-122g19.1 / 101884707 ZFINID:ZDB-GENE-110411-239 Length:337 Species:Danio rerio


Alignment Length:163 Identity:34/163 - (20%)
Similarity:61/163 - (37%) Gaps:27/163 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 WTREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEF 83
            |.:|....|:.:      ::..:.:|.....:|:....|..|..:...|....::|:.....||.
Zfish   187 WKKENLLNQLKK------ILTGDGWTYNQSSFYYKSNISKTWIVSRSDCIARGADLIIINNQQEQ 245

  Fly    84 DAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLR-WA--RNQPDNAGQKEHCIHLG- 144
            |    |:....:....|...||:...|:.||...:...:.|. ||  .|:| |....|:|:... 
Zfish   246 D----FVMRKSNVAAVWIGLNDIIVEGTWRWVDGSAMKNDLSFWASGSNEP-NGDTNENCVVSAD 305

  Fly   145 ----YIYKDSRKFELNDRPCSQDPNSLFKYICE 173
                :.|...    .:|..|.:    .|::|||
Zfish   306 KVTEWPYTSG----WSDVSCER----TFQWICE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 28/129 (22%)
si:ch73-122g19.1XP_005155331.2 CLECT_DC-SIGN_like 203..331 CDD:153060 31/141 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.