DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and LOC101882781

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_005155516.1 Gene:LOC101882781 / 101882781 -ID:- Length:278 Species:Danio rerio


Alignment Length:91 Identity:20/91 - (21%)
Similarity:38/91 - (41%) Gaps:15/91 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AEPFTKI--NDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTS 102
            |:.|..|  |:..||..:|..:|.::.:.|::..::|...::.:|.......:..|     :|..
Zfish   166 ADKFRWICYNNSLYFISSEMKSWSDSRQDCQQRRADLAIIKSPEEKTFFQKVVDRN-----FWIG 225

  Fly   103 GNDLAKTGSHRW-----FTNAQRISS 123
               |.||...:|     .||..:..|
Zfish   226 ---LTKTDVWKWLDGTVLTNGSKTDS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 16/78 (21%)
LOC101882781XP_005155516.1 CLECT_NK_receptors_like 170..274 CDD:153063 18/87 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.