DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and LOC101882781

DIOPT Version :10

Sequence 1:NP_477200.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_005155516.2 Gene:LOC101882781 / 101882781 -ID:- Length:278 Species:Danio rerio


Alignment Length:91 Identity:20/91 - (21%)
Similarity:38/91 - (41%) Gaps:15/91 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 AEPFTKI--NDGYYFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTS 102
            |:.|..|  |:.:||..:|..:|.::.:.|::..::|...::.:|.......:..|     :|..
Zfish   166 ADKFRWICYNNSFYFISSEMKSWSDSRQDCQQRRADLAIIKSPEEKTFFQKVVDRN-----FWIG 225

  Fly   103 GNDLAKTGSHRW-----FTNAQRISS 123
               |.||...:|     .||.....|
Zfish   226 ---LTKTDVWKWLDGTVLTNGSETDS 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_477200.1 CLECT 51..173 CDD:153057 16/78 (21%)
LOC101882781XP_005155516.2 None

Return to query results.
Submit another query.