DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lectin-galC1 and si:dkey-187i8.2

DIOPT Version :9

Sequence 1:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster
Sequence 2:XP_021335897.1 Gene:si:dkey-187i8.2 / 101882603 ZFINID:ZDB-GENE-121214-181 Length:635 Species:Danio rerio


Alignment Length:169 Identity:39/169 - (23%)
Similarity:70/169 - (41%) Gaps:34/169 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ITLLVIAKTGWTREKFSIQVNEGNTFGALVKAEPFTKINDGYYFFGTESLNWYEAYEKCRELNSE 73
            |:.|:..:...|:||..:...:|           :.......||..:.:.:|.|:.:.|....::
Zfish   494 ISDLIEQRDQLTKEKTELSNMDG-----------WVYFQSSLYFLSSLTKSWEESRKDCIARGAD 547

  Fly    74 LVTFETDQEFDAVTAFLTANGSRLTYWTSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKE 138
            ||.....:|.:.|....   |..|. |....|:.:.|:.:|...:::.|..|:.|::..|..:||
Zfish   548 LVIINNGKEQEMVNMIC---GDVLV-WIGLTDIEEEGTWKWVDGSKQTSGFRYWRSREPNGNRKE 608

  Fly   139 HCI----HLGYIYKDSRKFELNDRPCSQDPNSLFKYICE 173
            :|:    | |:|  |.|..|.|            |:|||
Zfish   609 NCVLTDAH-GWI--DHRCHEAN------------KWICE 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 31/125 (25%)
si:dkey-187i8.2XP_021335897.1 SMC_N <113..507 CDD:330553 3/12 (25%)
CLECT_DC-SIGN_like 515..633 CDD:153060 34/148 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.